Adenylate Cyclase 5 Antibody (3E6.)

Images

 
Sandwich ELISA: Adenylate Cyclase 5 Antibody (3E6) [H00000111-M01] - Detection limit for recombinant GST tagged ADCY5 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3E6.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Adenylate Cyclase 5 Antibody (3E6.) Summary

Immunogen
ADCY5 (NP_899200, 1152 a.a. - 1261 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPPLS
Specificity
ADCY5 (3E6)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ADCY5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00000111-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Adenylate Cyclase 5 Antibody (3E6.)

  • AC5
  • adenylate cyclase 5
  • adenylate cyclase type 5
  • Adenylate cyclase type V
  • Adenylyl cyclase 5
  • ATP pyrophosphate-lyase 5
  • EC 4.6.1.1

Background

ADCY5 belongs to the adenylate cyclase (EC 4.6.1.1) family of enzymes responsible for the synthesis of cAMP (Ludwig and Seuwen, 2002 [PubMed 12503609]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59023
Species: Hu
Applications: WB
NBP1-33659
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90278
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00010141-P01
Species: Hu
NBP1-92683
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-15294
Species: Hu, Mu
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP2-37920
Species: Hu
Applications: IHC, IHC-P
NBP2-30380
Species: Hu
Applications: IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Adenylate Cyclase 5 Antibody (H00000111-M01)(1)

Reviews for Adenylate Cyclase 5 Antibody (H00000111-M01) (0)

There are no reviews for Adenylate Cyclase 5 Antibody (H00000111-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Adenylate Cyclase 5 Antibody (H00000111-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Adenylate Cyclase 5 Products

Bioinformatics Tool for Adenylate Cyclase 5 Antibody (H00000111-M01)

Discover related pathways, diseases and genes to Adenylate Cyclase 5 Antibody (H00000111-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Adenylate Cyclase 5 Antibody (H00000111-M01)

Discover more about diseases related to Adenylate Cyclase 5 Antibody (H00000111-M01).
 

Pathways for Adenylate Cyclase 5 Antibody (H00000111-M01)

View related products by pathway.

PTMs for Adenylate Cyclase 5 Antibody (H00000111-M01)

Learn more about PTMs related to Adenylate Cyclase 5 Antibody (H00000111-M01).
 

Research Areas for Adenylate Cyclase 5 Antibody (H00000111-M01)

Find related products by research area.

Blogs on Adenylate Cyclase 5

There are no specific blogs for Adenylate Cyclase 5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Adenylate Cyclase 5 Antibody (3E6.) and receive a gift card or discount.

Bioinformatics

Gene Symbol ADCY5
Entrez
OMIM
Uniprot