Recombinant Human ADA2a Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ADA2a Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-305 of Human TADA2L full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDRLGSFSNDPSDKPPCRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGFEYKKHRSDHTYEIMTSDFPVLDPSWTAQEEMALLEAVMDCGFGNWQDVANQMCTKTKEECEKHYMKYFINNPLFASTLLNLKQAEEAKTADTAIPFHSTDDPPRPTFDSLLSRDMAGYMPARADFIEEFDNYAEWDLRDIDFVEDDSDILHALKMAVVDIYHSRLKERQRRKKIIRDHGLINLRKFQLMERRYPKEVQDLYETMRRFARIVGPVEHDKFIESHACRWFLSLEQYLCVYIYINRRDNGVFYVKFYK

Protein/Peptide Type
Recombinant Protein
Gene
TADA2A

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ADA2a Protein

  • ADA2AFLJ12705
  • ADA2-like protein
  • hADA2
  • TADA2LADA2
  • transcriptional adapter 2-alpha
  • Transcriptional adapter 2-like
  • transcriptional adaptor 2 (ADA2 homolog, yeast)-like
  • transcriptional adaptor 2 alpha
  • transcriptional adaptor 2A

Background

TADA2L( AAH01172, 1 a.a. - 306 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-17017
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-56629
Species: Hu
Applications: WB
NBP1-90243
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
H00093624-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
H00008850-M04
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-89238
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP2-45466
Species: Hu
Applications: WB, IHC
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF7365
Species: Hu, Mu, Rt
Applications: WB
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, PLA
AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
H00006871-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for ADA2a Recombinant Protein (H00006871-P01) (0)

There are no publications for ADA2a Recombinant Protein (H00006871-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADA2a Recombinant Protein (H00006871-P01) (0)

There are no reviews for ADA2a Recombinant Protein (H00006871-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADA2a Recombinant Protein (H00006871-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ADA2a Products

Bioinformatics Tool for ADA2a Recombinant Protein (H00006871-P01)

Discover related pathways, diseases and genes to ADA2a Recombinant Protein (H00006871-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADA2a Recombinant Protein (H00006871-P01)

Discover more about diseases related to ADA2a Recombinant Protein (H00006871-P01).
 

Pathways for ADA2a Recombinant Protein (H00006871-P01)

View related products by pathway.

PTMs for ADA2a Recombinant Protein (H00006871-P01)

Learn more about PTMs related to ADA2a Recombinant Protein (H00006871-P01).
 

Research Areas for ADA2a Recombinant Protein (H00006871-P01)

Find related products by research area.

Blogs on ADA2a

There are no specific blogs for ADA2a, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ADA2a Antibody
NBP2-57507

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ADA2a Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TADA2A