ACTL7B Antibody - BSA Free

Analysis in human testis and kidney tissues Corresponding ACTL7B RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ACTL7B Antibody [NBP1-86972] - Staining of human cerebral cortex, duodenum, kidney and testis using Anti-ACTL7B antibody NBP1-86972 (A) shows similar protein distribution across tissues to independent antibody NBP1-86973 (B).

Immunohistochemistry-Paraffin: ACTL7B Antibody [NBP1-86972] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: ACTL7B Antibody [NBP1-86972] - Staining of human kidney shows no positivity in cells in tubules as expected.

Immunohistochemistry-Paraffin: ACTL7B Antibody [NBP1-86972] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Immunohistochemistry-Paraffin: ACTL7B Antibody [NBP1-86972] - Staining of human duodenum shows no positivity in glandular cells as expected.

Analysis in control (vector only transfected HEK293T lysate) and ACTL7B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ACTL7B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ACTL7B Antibody - BSA Free (NBP1-86972) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LTNYLMQLLNEAGHAFTDDHLHIIEHIKKKCCYAAFLPEEELGLVPEELRVDYELPDGKLITIGQERFRCSEMLFQPSL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACTL7B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ACTL7B Protein (NBP1-86972PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ACTL7B Antibody - BSA Free

• actin-like 7B
• actin-like 7-beta
• actin-like protein 7B
• actin-like-7-beta
• Tact1

Background

ACTL7B is encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene (ACTL7B), and related gene, ACTL7A, are intronless, and are located approximately 4 kb apart in a head-to-head orientation within the familial dysautonomia candidate region on 9q31. Based on mutational analysis of the ACTL7B gene in patients with this disorder, it was concluded that it is unlikely to be involved in the pathogenesis of dysautonomia. Unlike ACTL7A, the ACTL7B gene is expressed predominantly in the testis, however, its exact function is not known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ACTL7B