Recombinant Human ZSCAN2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ZSCAN2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-150 of Human ZSCAN2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MMAADIPRVTTPLSSLVQVPQEEDRQEEEVTTMILEDDSWVQEAVLQEDGPESEPFPQSAGKGGPQEEVTRGPQGALGRLRELCRRWLRPEVHTKEQMLTMLPKEIQAWLQEHRPESSEEAAALVEDLTQTLQDSAVAVFASLPVEVTSL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ZSCAN2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZSCAN2 Protein

  • FLJ20595
  • ZFP29
  • zfp-29
  • zinc finger and SCAN domain containing 2
  • zinc finger and SCAN domain-containing protein 2
  • Zinc finger protein 29 homolog
  • Zinc finger protein 854
  • ZNF854zinc finger protein 29

Background

The protein encoded by this gene contains several copies of zinc finger motif, which is commonly found in transcriptional regulatory proteins. Studies in mice show that this gene is expressed during embryonic development, and specifically in the testis in adult mice, suggesting that it may play a role in regulating genes in germ cells. Alternative splicing of this gene results in several transcript variants encoding different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46033
Species: Hu
Applications: WB, IHC
NBP1-76539
Species: Hu, Mu
Applications: WB, ELISA, ICC
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP1-25966
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-35006
Species: Hu
NBP2-19779
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for ZSCAN2 Recombinant Protein (H00054993-P01) (0)

There are no publications for ZSCAN2 Recombinant Protein (H00054993-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZSCAN2 Recombinant Protein (H00054993-P01) (0)

There are no reviews for ZSCAN2 Recombinant Protein (H00054993-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZSCAN2 Recombinant Protein (H00054993-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZSCAN2 Products

Bioinformatics Tool for ZSCAN2 Recombinant Protein (H00054993-P01)

Discover related pathways, diseases and genes to ZSCAN2 Recombinant Protein (H00054993-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZSCAN2

There are no specific blogs for ZSCAN2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Chk1 Antibody
NB100-464
ZSCAN2 Antibody
NBP1-82169

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZSCAN2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZSCAN2