ZNF778 Antibody

Images

 
Western Blot: ZNF778 Antibody [NBP1-80436] - PANC1 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF778 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human ZNF778. Peptide sequence MAAPDLAHGGHVSRDSVCLHEEQTQAAGMVAGWLINCYQDAVTFDDVAVD.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF778
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against ZNF778 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZNF778 Antibody

  • FLJ31875
  • MGC150573
  • zinc finger protein 778

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

27880002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-01860
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC
AF4096
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC

Publications for ZNF778 Antibody (NBP1-80436) (0)

There are no publications for ZNF778 Antibody (NBP1-80436).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF778 Antibody (NBP1-80436) (0)

There are no reviews for ZNF778 Antibody (NBP1-80436). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF778 Antibody (NBP1-80436) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF778 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF778
Uniprot