ZNF630 Antibody


Immunohistochemistry-Paraffin: ZNF630 Antibody [NBP2-55223] - Immunohistochemical staining of human ovary shows strong nuclear positivity in ovarian stroma cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

ZNF630 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VTFEDVAVDFTQEEWQQLNPAQKTLHRDVMLETYNHLVSVGCSGIKPDVIFKLEHGKDPWIIESELSRWIYPDRVKGLESSQQIISGELLFQREILERAPKDNSL
Specificity of human ZNF630 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZNF630 Recombinant Protein Antigen (NBP2-55223PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for ZNF630 Antibody

  • DJ54B20.2 (Novel KRAB Box Containing C2H2 Type Zinc Finger Protein)
  • DJ54B20.2
  • Zinc Finger Protein 630


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ZNF630 Antibody (NBP2-55223) (0)

There are no publications for ZNF630 Antibody (NBP2-55223).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF630 Antibody (NBP2-55223) (0)

There are no reviews for ZNF630 Antibody (NBP2-55223). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ZNF630 Antibody (NBP2-55223) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional ZNF630 Products

Bioinformatics Tool for ZNF630 Antibody (NBP2-55223)

Discover related pathways, diseases and genes to ZNF630 Antibody (NBP2-55223). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZNF630

There are no specific blogs for ZNF630, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZNF630 Antibody and receive a gift card or discount.


Gene Symbol ZNF630