ZNF598 Antibody

Images

 
Western Blot: ZNF598 Antibody [NBP1-84659] - Analysis in human cell line SCLC-21H.
Immunocytochemistry/ Immunofluorescence: ZNF598 Antibody [NBP1-84659] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF598 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VVGGEDYEEVDRYSRQGRVARAGTRGAQQSRRGSWRYKREEEDREVAAAVRASVAAQQQEEARRSEDQEEGGRPKKEEAAARGPEDPRGPRRSPRTQGEGPGPKETSTNGPVSQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF598
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF598 Protein (NBP1-84659PEP)
Publications
Read Publication using
NBP1-84659 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse (81%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF598 Antibody

  • DKFZp762F135
  • FLJ00086
  • zinc finger protein 598

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12812
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-03611
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84659
Species: Hu
Applications: WB, ICC/IF

Publications for ZNF598 Antibody (NBP1-84659)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species
Showing Publication 1 - 1 of 1.
Publication using NBP1-84659 Applications Species
Clancy A, Heride C, Pinto-Fernandez A, Kallinos A The deubiquitylase USP9X controls ribosomal stalling BioRxiv Jan 1 2020 (WB, Human) WB Human

Reviews for ZNF598 Antibody (NBP1-84659) (0)

There are no reviews for ZNF598 Antibody (NBP1-84659). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZNF598 Antibody (NBP1-84659) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZNF598 Products

Bioinformatics Tool for ZNF598 Antibody (NBP1-84659)

Discover related pathways, diseases and genes to ZNF598 Antibody (NBP1-84659). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for ZNF598 Antibody (NBP1-84659)

View related products by pathway.

Blogs on ZNF598

There are no specific blogs for ZNF598, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF598 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF598