ZNF484 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZNF484 Antibody [NBP1-88750] - Staining of human cell line U-251 MG shows localization to nucleoplasm & nuclear membrane.
Immunohistochemistry-Paraffin: ZNF484 Antibody [NBP1-88750] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF484 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EQEEPCMLDGEIPSQSRPDGDIGFGPLQQRMSEEVSFQSEININLFTRDDPYSILEELWKDDEHTRKCGENQNKPLSRVVFINKKTLANDSIFEYKDIGEIVHVNTHLVSSRKRPHNCNSCGKNLEPIITLYNRNNATENSDKTIG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF484
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF484 Protein (NBP1-88750PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF484 Antibody

  • Kruppel-associated box protein
  • zinc finger protein 226

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009322-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB500-218
Species: Hu, Mu
Applications: WB
H00003090-M02
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-13963
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88750
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ZNF484 Antibody (NBP1-88750) (0)

There are no publications for ZNF484 Antibody (NBP1-88750).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF484 Antibody (NBP1-88750) (0)

There are no reviews for ZNF484 Antibody (NBP1-88750). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZNF484 Antibody (NBP1-88750) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF484 Products

Bioinformatics Tool for ZNF484 Antibody (NBP1-88750)

Discover related pathways, diseases and genes to ZNF484 Antibody (NBP1-88750). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF484 Antibody (NBP1-88750)

Discover more about diseases related to ZNF484 Antibody (NBP1-88750).
 

Pathways for ZNF484 Antibody (NBP1-88750)

View related products by pathway.

PTMs for ZNF484 Antibody (NBP1-88750)

Learn more about PTMs related to ZNF484 Antibody (NBP1-88750).

Blogs on ZNF484

There are no specific blogs for ZNF484, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF484 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF484