ZNF483 Antibody - Azide and BSA Free

Western Blot: ZNF483 Antibody [H00158399-B01P] - Analysis of ZNF483 expression in transfected 293T cell line by ZNF483 polyclonal antibody. Lane 1: ZNF483 transfected lysate(26.84 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: ZNF483 Antibody [H00158399-B01P] - Analysis of purified antibody to ZNF483 on HeLa cell. (antibody concentration 10 ug/ml)

Immunohistochemistry-Paraffin: ZNF483 Antibody [H00158399-B01P] - Analysis of purified antibody to ZNF483 on formalin-fixed paraffin-embedded human cerebral cortex. (antibody concentration 3 ug/ml)

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ZNF483 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse ZNF483 Antibody - Azide and BSA Free (H00158399-B01P) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: ZNF483 (AAH65738.1, 1 a.a. - 244 a.a.) full-length human protein. MQAVVPLNKMTAISPEPQTLASTEQNEVPRVVTSGEQEAILRGNAADAESFRQRFRWFCYSEVAGPRKALSQLWELCNQWLRPDIHTKEQILELLVFEQFLTILPGEIRIWVKSQHPESSEEVVTLIEDLTQMLEEKDPVSQDSTVSQEENSKEDKMVTVCPNTESCESITLKDVAVNFSRGEWKKLEPFQKELYKEVLLENLRNLEFLDFPVSKLELISQLKWVELPWLLEEVSKSSRLGSVI
• Specificity: ZNF483 - zinc finger protein 483,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: ZNF483
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. May also be used for immunofluorescence, immunohistochemistry (paraffin).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF483 Antibody - Azide and BSA Free

• BMZF-2zinc finger 2, bone marrow
• BMZF2zinc finger protein 27 (KOX 22)
• Bone marrow zinc finger 2
• KOX22Zinc finger protein 233
• zinc finger protein 224
• Zinc finger protein 255Zinc finger protein KOX22
• Zinc finger protein 27
• ZNF255zinc finger protein ZNF255
• ZNF27ZNF233

Background

ZNF483 may be involved in transcriptional regulation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNF483
• Entrez:
  • 158399(Human)
• Uniprot:
  • AAH65738.1(Human)