ZNF45 Antibody

Images

 
Western Blot: ZNF45 Antibody [NBP1-82359] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: ZNF45 Antibody [NBP1-82359] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF45 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LWMMKMATQRDNSSGAKNLKEMETLQEVGLRYLPHEELFCSQIWQQITRELIKYQDSVVNIQRTGCQLEKRDDLHYKDEGFSNQSSHLQVHR
Specificity
Specificity of human ZNF45 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF45
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZNF45 Protein (NBP1-82359PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF45 Antibody

  • HZF1Zinc finger protein HZF1
  • KIAA2007
  • zinc finger protein 1
  • zinc finger protein 266

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84108
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30794
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-59679
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13552
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81758
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56078
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81347
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00007576-P01
Species: Hu
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-13577
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30999
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92619
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49161
Species: Hu
Applications: IHC, IHC-P
NBP1-79358
Species: Hu
Applications: WB
NBP1-82897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30747
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81344
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4265
Species: Hu, Mu, Rt
Applications: WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for ZNF45 Antibody (NBP1-82359) (0)

There are no publications for ZNF45 Antibody (NBP1-82359).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF45 Antibody (NBP1-82359) (0)

There are no reviews for ZNF45 Antibody (NBP1-82359). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF45 Antibody (NBP1-82359) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ZNF45 Antibody (NBP1-82359)

Discover related pathways, diseases and genes to ZNF45 Antibody (NBP1-82359). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF45 Antibody (NBP1-82359)

Discover more about diseases related to ZNF45 Antibody (NBP1-82359).
 

Pathways for ZNF45 Antibody (NBP1-82359)

View related products by pathway.

PTMs for ZNF45 Antibody (NBP1-82359)

Learn more about PTMs related to ZNF45 Antibody (NBP1-82359).

Blogs on ZNF45

There are no specific blogs for ZNF45, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF45 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF45