ZNF334 Antibody

Images

 
Western Blot: ZNF334 Antibody [NBP1-79707] - Hela cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF334 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human ZNF334The immunogen for this antibody is ZNF334. Peptide sequence KMKKFQIPVSFQDLTVNFTQEEWQQLDPAQRLLYRDVMLENYSNLVSVGY. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF334
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ZNF334 and was validated on Western blot.
Theoretical MW
80 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZNF334 Antibody

  • DKFZp586G1122
  • Hzf
  • HZFzinc finger protein 385
  • RZFHematopoietic zinc finger protein
  • ZFP385
  • zinc finger protein 385A
  • ZNF385Retinal zinc finger protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00764
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
MAB342
Species: Hu
Applications: AgAct, ICC, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
5334-KL
Species: Hu
Applications: BA

Publications for ZNF334 Antibody (NBP1-79707) (0)

There are no publications for ZNF334 Antibody (NBP1-79707).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF334 Antibody (NBP1-79707) (0)

There are no reviews for ZNF334 Antibody (NBP1-79707). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF334 Antibody (NBP1-79707) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF334 Products

Bioinformatics Tool for ZNF334 Antibody (NBP1-79707)

Discover related pathways, diseases and genes to ZNF334 Antibody (NBP1-79707). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF334 Antibody (NBP1-79707)

Discover more about diseases related to ZNF334 Antibody (NBP1-79707).

Blogs on ZNF334

There are no specific blogs for ZNF334, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF334 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF334
Uniprot