ZNF214 Antibody (8E7)

Images

 
Sandwich ELISA: ZNF214 Antibody (7E7) [H00007761-M02] - Detection limit for recombinant GST tagged ZNF214 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
8E7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ZNF214 Antibody (8E7) Summary

Immunogen
ZNF214 (NP_037381, 210 a.a. ~ 319 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LRDSMEEKYCGCNKCKGIYYWNSRCVFHKRNQPGENLCQCSIRKACFSQRSDLYRHPRNHIGKKLYGCDEVDGNFHQSSGVHFHQRVHIGEVPYSCNACGKSFSQISSLH
Specificity
ZNF214 (7E7)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ZNF214
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF214 Antibody (8E7)

  • BAZ 1
  • BAZ1
  • BAZ-1
  • BWSCR2-Associated Zinc Finger Protein 1
  • DKFZp564D0764
  • Early hematopoietic zinc finger protein
  • early hematopoietic zinc finger
  • EHZFLIP3
  • Evi3
  • LYST-interacting protein 3
  • MGC142182
  • MGC142208
  • zinc finger protein 521

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00007762-M01
Species: Hu
Applications: ELISA, KD, WB
NBP3-06103
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP1-81223
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88182
Species: Hu
Applications: IHC, IHC-P, WB
NB100-2832
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
H00057492-M02
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NLS4753
Species: Dr, Eq, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-86659
Species: Hu
Applications: WB

Publications for ZNF214 Antibody (H00007761-M02) (0)

There are no publications for ZNF214 Antibody (H00007761-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF214 Antibody (H00007761-M02) (0)

There are no reviews for ZNF214 Antibody (H00007761-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF214 Antibody (H00007761-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF214 Products

Array H00007761-M02

Bioinformatics Tool for ZNF214 Antibody (H00007761-M02)

Discover related pathways, diseases and genes to ZNF214 Antibody (H00007761-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF214 Antibody (H00007761-M02)

Discover more about diseases related to ZNF214 Antibody (H00007761-M02).
 

Pathways for ZNF214 Antibody (H00007761-M02)

View related products by pathway.

Blogs on ZNF214

There are no specific blogs for ZNF214, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF214 Antibody (8E7) and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF214
Entrez
OMIM
Uniprot