ZMYND19 Antibody - Azide and BSA Free

Western Blot: ZMYND19 Antibody [H00116225-B01P] - Analysis of ZMYND19 expression in transfected 293T cell line by ZMYND19 polyclonal antibody. Lane 1: ZMYND19 transfected lysate(24.97 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ZMYND19 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse ZMYND19 Antibody - Azide and BSA Free (H00116225-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: ZMYND19 (NP_612471, 1 a.a. - 227 a.a.) full-length human protein. MTDFKLGIVRLGRVAGKTKYTLIDEQDIPLVESYSFEARMEVDADGNGAKIFAYAFDKNRGRGSGRLLHELLWERHRGGVAPGFQVVHLNAVTVDNRLDNLQLVPWGWRPKAEETSSKQREQSLYWLAIQQLPTDPIEEQFPVLNVTRYYNANGDVVEEEENSCTYYECHYPPCTVIEKQLREFNICGRCQVARYCGSQCQQKDWPAHKKHCRERKRPFQHELEPER
• Specificity: ZMYND19 - zinc finger, MYND-type containing 19,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: ZMYND19
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZMYND19 Antibody - Azide and BSA Free

• MCH-R1-interacting zinc finger protein
• Melanin-concentrating hormone receptor 1-interacting zinc finger protein
• MIZIPmelanin-concentrating hormone receptor 1 interacting zinc-finger protein
• RP11-48C7.4
• zinc finger MYND domain-containing protein 19
• zinc finger, MYND domain containing 19
• zinc finger, MYND-type containing 19

Background

ZMYND19 is a MYND zinc finger domain-containing protein that binds to the C terminus of melanin-concentrating hormone receptor-1 (MCHR1; MIM 601751) (Bachner et al., 2002 [PubMed 12208518]), and to the N termini of alpha-tubulin (TUBA1; MIM 191110), and beta-tubulin (TUBB; MIM 191130) (Francke et al., 2005 [PubMed 16039987]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZMYND19
• Entrez:
  • 116225(Human)
• Uniprot:
  • NP_612471(Human)