ZFP62 Antibody


Immunocytochemistry/ Immunofluorescence: ZFP62 Antibody [NBP2-13547] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & actin filaments.
Immunohistochemistry-Paraffin: ZFP62 Antibody [NBP2-13547] - Staining of human bone marrow shows strong cytoplasmic positivity in subset of hematopoietic cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

ZFP62 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RTHTGEESLNVIYVGSYSGTSQKRTYEGGNALDGGRMRMPL
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZFP62 Protein (NBP2-13547PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ZFP62 Antibody

  • ZET
  • ZFP62 zinc finger protein 62 homolog (mouse)
  • ZNF755


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready

Publications for ZFP62 Antibody (NBP2-13547) (0)

There are no publications for ZFP62 Antibody (NBP2-13547).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZFP62 Antibody (NBP2-13547) (0)

There are no reviews for ZFP62 Antibody (NBP2-13547). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZFP62 Antibody (NBP2-13547) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ZFP62 Products

ZFP62 NBP2-13547

Bioinformatics Tool for ZFP62 Antibody (NBP2-13547)

Discover related pathways, diseases and genes to ZFP62 Antibody (NBP2-13547). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZFP62 Antibody (NBP2-13547)

Discover more about diseases related to ZFP62 Antibody (NBP2-13547).

Blogs on ZFP62

There are no specific blogs for ZFP62, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZFP62 Antibody and receive a gift card or discount.


Gene Symbol ZFP62