ZDBF2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZDBF2 Antibody [NBP2-14501] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol.
Immunohistochemistry-Paraffin: ZDBF2 Antibody [NBP2-14501] - Staining of human prostate shows strong cytoplasmic, membranous and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZDBF2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TDMPSNKGIFEDTIAKNHEEFFSNMDCTQEEKHLVFNKTAFWEQKCSVSS EMKFDCISLQSASDQPQETAQDLSLWKEEQIDQEDNYE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZDBF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZDBF2 Protein (NBP2-14501PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZDBF2 Antibody

  • ZDBF2 zinc finger, DBF-type containing 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00091833-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NLS74
Species: Hu
Applications: IHC, IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-13888
Species: Hu, Mu
Applications: WB, ChIP, Flow, ICC/IF, IHC-P, CyTOF-ready, IHC-WhMt

Publications for ZDBF2 Antibody (NBP2-14501) (0)

There are no publications for ZDBF2 Antibody (NBP2-14501).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZDBF2 Antibody (NBP2-14501) (0)

There are no reviews for ZDBF2 Antibody (NBP2-14501). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZDBF2 Antibody (NBP2-14501) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZDBF2 Products

ZDBF2 NBP2-14501

Bioinformatics Tool for ZDBF2 Antibody (NBP2-14501)

Discover related pathways, diseases and genes to ZDBF2 Antibody (NBP2-14501). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for ZDBF2 Antibody (NBP2-14501)

View related products by pathway.

PTMs for ZDBF2 Antibody (NBP2-14501)

Learn more about PTMs related to ZDBF2 Antibody (NBP2-14501).

Blogs on ZDBF2

There are no specific blogs for ZDBF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZDBF2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZDBF2