We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

WW domain binding protein 5 Antibody - BSA Free

Images

 
Western Blot: WW domain binding protein 5 Antibody [NBP2-83764] - Host: Rabbit. Target Name: WBP5. Sample Tissue: Human HCT116 Whole Cell. Antibody Dilution: 3ug/ml
Western Blot: WW domain binding protein 5 Antibody [NBP2-83764] - Host: Rabbit. Target Name: WBP5. Sample Type: Jurkat Whole Cell lysates. Antibody Dilution: 1.0ug/ml
Western Blot: WW domain binding protein 5 Antibody [NBP2-83764] - Host: Rabbit. Target Name: WBP5. Sample Tissue: Human K562 Whole Cell. Antibody Dilution: 5ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Concentration
0.5 mg/ml

Order Details

WW domain binding protein 5 Antibody - BSA Free Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human WW domain binding protein 5. Peptide sequence: QKMEGKPENESEPKHEEEPKPEEKPEEEEKLEEEAKAKGTFRERLIQSLQ The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
TCEAL9
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for WW domain binding protein 5 Antibody - BSA Free

  • DKFZp313K1940
  • N4
  • NDFIP1
  • pp21 homolog
  • TCEAL9
  • WBP-5
  • WW domain binding protein 1
  • WW domain binding protein 5
  • WW domain-binding protein 5

Background

The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding of polyproline ligands. This gene encodes a WW domain binding protein. This gene also encodes a domain with similarity to the transcription elongation factor A, SII-related family. Alternative splicing results in multiple transcript variants encoding a single isoform. Transcript Variant: This variant (1) represents the longest transcript. Variants 1 through 4 encode the same isoform.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-40256
Species: Hu, Mu, Pl, Po, Rb, Rt
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KO, Simple Western, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
AF800
Species: Hu, Mu
Applications: IP, Simple Western, WB
NBP2-46439
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-31660
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-56146
Species: Hu
Applications: IHC,  IHC-P, IP, WB

Publications for WW domain binding protein 5 Antibody (NBP2-83764) (0)

There are no publications for WW domain binding protein 5 Antibody (NBP2-83764).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WW domain binding protein 5 Antibody (NBP2-83764) (0)

There are no reviews for WW domain binding protein 5 Antibody (NBP2-83764). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WW domain binding protein 5 Antibody (NBP2-83764) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WW domain binding protein 5 Products

Research Areas for WW domain binding protein 5 Antibody (NBP2-83764)

Find related products by research area.

Blogs on WW domain binding protein 5

There are no specific blogs for WW domain binding protein 5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WW domain binding protein 5 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol TCEAL9