WW domain binding protein 5 Antibody - BSA Free

Western Blot: WW domain binding protein 5 Antibody [NBP2-83764] - Host: Rabbit. Target Name: WBP5. Sample Tissue: Human HCT116 Whole Cell. Antibody Dilution: 3ug/ml

Western Blot: WW domain binding protein 5 Antibody [NBP2-83764] - Host: Rabbit. Target Name: WBP5. Sample Type: Jurkat Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Western Blot: WW domain binding protein 5 Antibody [NBP2-83764] - Host: Rabbit. Target Name: WBP5. Sample Tissue: Human K562 Whole Cell. Antibody Dilution: 5ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

WW domain binding protein 5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit WW domain binding protein 5 Antibody - BSA Free (NBP2-83764) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human WW domain binding protein 5. Peptide sequence: QKMEGKPENESEPKHEEEPKPEEKPEEEEKLEEEAKAKGTFRERLIQSLQ The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TCEAL9
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for WW domain binding protein 5 Antibody - BSA Free

• DKFZp313K1940
• N4
• NDFIP1
• pp21 homolog
• TCEAL9
• WBP-5
• WW domain binding protein 1
• WW domain binding protein 5
• WW domain-binding protein 5

Background

The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding of polyproline ligands. This gene encodes a WW domain binding protein. This gene also encodes a domain with similarity to the transcription elongation factor A, SII-related family. Alternative splicing results in multiple transcript variants encoding a single isoform. Transcript Variant: This variant (1) represents the longest transcript. Variants 1 through 4 encode the same isoform.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TCEAL9