Home » WDSOF1 » WDSOF1 Research Products » WDSOF1 Recombinant Protein Antigen

WDSOF1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for WDSOF1 Protein (NBP2-47580PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

WDSOF1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DCAF13.

Source: E.coli

Amino Acid Sequence: GIGTRFCGTSFFTVGDDKTVKQWKMDGPGYGDEEEPLHTILGKTVYTGIDHHWKEAVFATCGQQVDIWDEQRTNPICSMTWGFD
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DCAF13
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-47580.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for WDSOF1 Recombinant Protein Antigen

  • DDB1 and CUL4 associated factor 13
  • DKFZp564O0463
  • GM83
  • HSPC064
  • MGC126859
  • MGC138247
  • WD repeat and SOF domain-containing protein 1
  • WD repeats and SOF1 domain containing
  • WDSOF1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

ER alpha/NR3A1
Antibody (33)
NB300-560
Western Blot: ER alpha/NR3A1 Antibody (33) [NB300-560] - Analysis of recombinant ER alpha.
Immunohistochemistry-Paraffin: ER alpha/NR3A1 Antibody (33) [NB300-560] - Human breast tissue (B) and magnified section (C) compared with an isotype control (A).
Immunohistochemistry-Frozen: ER alpha/NR3A1 Antibody (33) [NB300-560] - Human breast carcinoma (B) and magnified section (C) compared with an isotype control (A).
(1 Review)
(7 Publications)
Species: Hu, Mu, Rt, Av, Bv, Ma, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
Bestrophin 1
Antibody (E6-6)
NB300-164
Dual RNAscope ISH-IHC: Bestrophin 1 Antibody (E6-6) [NB300-164] - Formalin-fixed paraffin-embedded tissue sections of human duodenum were probed for Bestrophin 1 mRNA (ACD RNAScope Probe, catalog # 433181; Fast Red chromogen, ACD catalog # 322360). Adjacent tissue section was processed for immunohistochemistry using mouse anti-human (Novus Biologicals catalog # NB300-164) at 0.3ug/mL with overnight incubation at 4 degrees Celsius followed by incubation with anti-mouse IgG VisUCyte HRP Polymer Antibody (Catalog # VC001) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). IHC signal is confined to cytoplasm.
Immunohistochemistry-Paraffin: Bestrophin 1 Antibody (E6-6) [NB300-164] - Bestrophin 1 was detected in immersion fixed paraffin sections of human small intestine using t Mouse Anti-Human Bestrophin 1 Monoclonal Antibody (Catalog # NB300-164) at 5 ug/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to the cell surface and extracellular.
Western Blot: Bestrophin 1 Antibody (E6-6) [NB300-164] - Western blot analysis of the normal and mutant human Best1 protein in transiently transfected MDCK cells. Best1 proteins are detectable as a 68 kDa band in all transfected cells, but not in non-transfected controls (MDCK lane). Actin bands are shown to indicate equal loading of cell lysates. Image collected and cropped by CiteAb from the following publication (http://www.mdpi.com/1422-0067/14/7/15121), licensed under a CC-BY licence.
(1 Review)
(39 Publications)
Species: Hu, Po, Ca, Pm, Rt(-)
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, Dual ISH-IHC
NDUFC2 Antibody
AF3357
NDUFC2 Antibody
(3 Publications)
Species: Mu
Applications: WB
SPG8 Antibody
NBP2-20471
Western Blot: SPG8 Antibody [NBP2-20471] - Sample (30 ug of whole cell lysate) A: HeLa 5% SDS PAGE gel, diluted at 1:500.
Immunohistochemistry-Paraffin: SPG8 Antibody [NBP2-20471] - Immunohistochemical analysis of paraffin-embedded Gastric ca, using antibody at 1:500 dilution.
(1 Review)
Species: Hu
Applications: WB, IHC, IHC-P
SQLE Antibody
NBP2-32005
Western Blot: SQLE Antibody [NBP2-32005] - Analysis in human cell line MCF-7 and human cell line U-251 MG.
Immunohistochemistry-Paraffin: SQLE Antibody [NBP2-32005] - Staining in human testis and skeletal muscle tissues using NBP2-32005 antibody. Corresponding SQLE RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SQLE Antibody [NBP2-32005] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, IHC, IHC-P
UBR5/EDD Antibody
NB100-1591
Western Blot: UBR5/EDD Antibody [NB100-1591] - Samples: Whole cell lysate (50 ug) from HEK293T, Jurkat, and LNCaP cells prepared using NETN lysis buffer. Antibody: Affinity purified Rabbit UBR5/EDD Antibody (NB100-1591, lot 6) used for WB at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunohistochemistry-Paraffin: UBR5/EDD Antibody [NB100-1591] - Sample: FFPE section of human lung carcinoma. Antibody: Affinity purified rabbit UBR5/EDD Antibody (NB100-1591, lot 6) used at a dilution of 1:1,000 (1 ug/ml). Detection: DAB
Immunohistochemistry-Paraffin: UBR5/EDD Antibody [NB100-1591] - Sample: FFPE section of mouse plasmacytoma. Antibody: Affinity purified rabbit UBR5/EDD Antibody (NB100-1591, lot 6) used at a dilution of 1:1000 (1 ug/ml). Detection: DAB
(7 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, KD
Recombinant Human
MED30 GST (N-Term) Pr ...
H00090390-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
DSCC1 Antibody
H00079075-B01P
Western Blot: DSCC1 Antibody [H00079075-B01P] - Analysis of DSCC1 expression in A-431.
Immunocytochemistry/Immunofluorescence: DSCC1 Antibody [H00079075-B01P] - Analysis of purified antibody to DCC1 on HeLa cell. Antibody at 10 ug/mL.
Western Blot: DSCC1 Antibody [H00079075-B01P] - analysis of DCC1 expression in transfected 293T cell line by DCC1 MaxPab polyclonal antibody. Lane 1: DCC1 transfected lysate (43.23 kDa). Lane 2: Non-transfected lysate.
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, MiAr
ATP7b Antibody
NB100-360
Western Blot: ATP7b Antibody [NB100-360] - ATP7b detected in 20 ug of mouse brain membrane fraction.
Immunocytochemistry/Immunofluorescence: ATP7b Antibody [NB100-360] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-ATP7b [NB100-360] at a 1:100 dilution overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse DyLight 550 (Red) at 1:500. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry: ATP7b Antibody [NB100-360] - Analysis of ATP7b in mouse liver using DAB with hematoxylin counterstain.
(1 Review)
(15 Publications)
Species: Hu, Mu, Rt
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
ALG8 Antibody
NBP2-47550
Western Blot: ALG8 Antibody [NBP2-47550] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG.
Immunocytochemistry/Immunofluorescence: ALG8 Antibody [NBP2-47550] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ALG8 Antibody [NBP2-47550] - Staining of human colon tissue. Shows strong granular cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Dystrophin Antibody
NBP1-89953
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining in human skeletal muscle and tonsil tissues. Corresponding DMD RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human heart muscle shows strong membranous positivity in myocytes.
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human skeletal muscle shows strong membranous positivity in myocytes.
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Band 3 Antibody
(BIII 136)
NB120-11012
Western Blot: Band 3 Antibody (BIII 136) [NB120-11012] - Human erythrocytes ghosts extract was separated on SDS-PAGE and probed with Monoclonal Anti-Band 3 Clone: BIII-136. The antibody was developed using Goat Anti-Mouse IgG-Peroxidase and AEC substrate.
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
USP35 Antibody
NBP1-28733
Immunoprecipitation: USP35 Antibody [NBP1-28733] - Samples: Whole cell lysate from HeLa (5, 15 and 50 ug for WB; 1 mg for IP, 20% of IP loaded) and 293T (T; 50 ug) cells. Antibodies: Affinity purified rabbit anti-USP35 antibody used for WB at 0.1 ug/ml (A) and 1 ug/ml (B) and used for IP at 10 ug/mg lysate. USP35 was also immunoprecipitated by rabbit anti-USP35 antibody, which recognizes an upstream epitope. Detection: Chemiluminescence with exposure times of 3 minutes (A) and 30 seconds (B).
Immunoprecipitation: USP35 Antibody [NBP1-28733] - Samples: Whole cell lysate (1 mg for IP, 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-USP35 antibody used for IP at 10 ug/mg lysate. USP35 was also immunoprecipitated by rabbit anti-USP35 antibody, which recognizes a downstream epitope. For blotting immunoprecipitated USP35, was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(1 Publication)
Species: Hu, Mu
Applications: WB, IP, KD
WDSOF1 Recombinant
Protein Antigen
NBP2-47580PEP
WDSOF1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for WDSOF1 Protein (NBP2-47580PEP) (0)

There are no publications for WDSOF1 Protein (NBP2-47580PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDSOF1 Protein (NBP2-47580PEP) (0)

There are no reviews for WDSOF1 Protein (NBP2-47580PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for WDSOF1 Protein (NBP2-47580PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Learn about Custom Antibody Labeling

Additional WDSOF1 Products

Array NBP2-47580PEP

Bioinformatics Tool for WDSOF1 Protein (NBP2-47580PEP)

Discover related pathways, diseases and genes to WDSOF1 Protein (NBP2-47580PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on WDSOF1

There are no specific blogs for WDSOF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Dual RNAscope ISH-IHC: Bestrophin 1 Antibody (E6-6) [NB300-164] - Formalin-fixed paraffin-embedded tissue sections of human duodenum were probed for Bestrophin 1 mRNA (ACD RNAScope Probe, catalog # 433181; Fast Red chromogen, ACD catalog # 322360). Adjacent tissue section was processed for immunohistochemistry using mouse anti-human (Novus Biologicals catalog # NB300-164) at 0.3ug/mL with overnight incubation at 4 degrees Celsius followed by incubation with anti-mouse IgG VisUCyte HRP Polymer Antibody (Catalog # VC001) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). IHC signal is confined to cytoplasm.
Bestrophin 1 Antibody (E6-6)
NB300-164
Western Blot: ATP7b Antibody [NB100-360] - ATP7b detected in 20 ug of mouse brain membrane fraction.
ATP7b Antibody
NB100-360
Western Blot: ER alpha/NR3A1 Antibody (33) [NB300-560] - Analysis of recombinant ER alpha.
ER alpha/NR3A1 Antibody (33)
NB300-560

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our WDSOF1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol DCAF13