VWC2L Antibody


Immunohistochemistry: VWC2L Antibody [NBP2-32456] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
Immunohistochemistry: VWC2L Antibody [NBP2-32456] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P

Order Details

VWC2L Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: GFVYKLGERFFPGHSNCPCVCALDGPVCDQPECPKIHPKCTKVEHNGCCPE
Specificity of human VWC2L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
VWC2L Protein (NBP2-32456PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for VWC2L Antibody

  • brorin-like
  • von Willebrand factor C domain containing protein 2-like
  • von Willebrand factor C domain-containing protein 2-like


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu
Applications: WB, ICC
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for VWC2L Antibody (NBP2-32456) (0)

There are no publications for VWC2L Antibody (NBP2-32456).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VWC2L Antibody (NBP2-32456) (0)

There are no reviews for VWC2L Antibody (NBP2-32456). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for VWC2L Antibody (NBP2-32456) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional VWC2L Products

Bioinformatics Tool for VWC2L Antibody (NBP2-32456)

Discover related pathways, diseases and genes to VWC2L Antibody (NBP2-32456). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VWC2L Antibody (NBP2-32456)

Discover more about diseases related to VWC2L Antibody (NBP2-32456).

Pathways for VWC2L Antibody (NBP2-32456)

View related products by pathway.

Blogs on VWC2L

There are no specific blogs for VWC2L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our VWC2L Antibody and receive a gift card or discount.


Gene Symbol VWC2L