Recombinant Human VSTM1 Protein

Images

 
SDS-Page: Recombinant Human VSTM1 Protein [H00284415-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human VSTM1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 174 of Human UNQ3033 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MTAEFLSLLCLGLCLGYEDEKKNEKPPKPSLHAWPSSVVEAESNVTLKCQAHSQNVTFVLRKVNDSGYKQEQSSAENEAEFPFTDLKPKDAGRYFCAYKTTASHEWSESSEHLQLVVTDKHDELEAPSMKTDTRTIFVAIFSCISILLLFLSVFIIYRCSQHSELRERKGREGE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
VSTM1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human VSTM1 Protein

  • LAIR Homolog
  • MGC119160
  • MGC119161
  • OSCAR-Like Transcript-1
  • signal inhibitory receptor on leukocytes-1
  • SIRL1
  • UNQ3033
  • V-set and transmembrane domain containing 1
  • V-set and transmembrane domain-containing protein 1
  • VSTM1
  • VSTM1-v1
  • VSTM1-v2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-82510
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-89106
Species: Hu
Applications: IHC, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-47812
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92170
Species: Hu
Applications: WB, IHC, IHC-P
MAB1633
Species: Mu
Applications: WB
H00284415-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for VSTM1 Recombinant Protein (H00284415-P01) (0)

There are no publications for VSTM1 Recombinant Protein (H00284415-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VSTM1 Recombinant Protein (H00284415-P01) (0)

There are no reviews for VSTM1 Recombinant Protein (H00284415-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VSTM1 Recombinant Protein (H00284415-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VSTM1 Products

VSTM1 H00284415-P01

Bioinformatics Tool for VSTM1 Recombinant Protein (H00284415-P01)

Discover related pathways, diseases and genes to VSTM1 Recombinant Protein (H00284415-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VSTM1 Recombinant Protein (H00284415-P01)

Discover more about diseases related to VSTM1 Recombinant Protein (H00284415-P01).

Blogs on VSTM1

There are no specific blogs for VSTM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CD4 Antibody
NBP1-19371

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human VSTM1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol VSTM1
Entrez