VPS37D Antibody

Images

 
Western Blot: VPS37D Antibody [NBP2-83753] - Host: Rabbit. Target Name: VPS37D. Sample Tissue: Mouse Thymus lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VPS37D Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of mouse VPS37D. Peptide sequence: AARGPPPAVPRSLPPLDSRPVPPVKGSPGCPFGPAPLLSPRPSQPEPPHR The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
VPS37D
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VPS37D Antibody

  • vacuolar protein sorting 37 homolog D (S. cerevisiae)
  • williams-Beuren syndrome chromosomal region 24 protein
  • williams-Beuren syndrome region protein 24

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82283
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-82052
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-85641
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2425
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-20872
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1397
Species: Hu, Mu, Rt, Ca, Ch, ChHa
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
H00051542-B01P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC
NBP2-20881
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for VPS37D Antibody (NBP2-83753) (0)

There are no publications for VPS37D Antibody (NBP2-83753).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VPS37D Antibody (NBP2-83753) (0)

There are no reviews for VPS37D Antibody (NBP2-83753). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VPS37D Antibody (NBP2-83753) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional VPS37D Products

Bioinformatics Tool for VPS37D Antibody (NBP2-83753)

Discover related pathways, diseases and genes to VPS37D Antibody (NBP2-83753). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VPS37D Antibody (NBP2-83753)

Discover more about diseases related to VPS37D Antibody (NBP2-83753).

Blogs on VPS37D

There are no specific blogs for VPS37D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VPS37D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VPS37D