Recombinant Human Vang-like Protein 1/VANGL1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Vang-like Protein 1/VANGL1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 247-321 of Human VANGL1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYNPNLLTASKFRAAKHMAGLKVYNVDGPSNNA

Protein/Peptide Type
Partial Recombinant Protein
Gene
VANGL1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Vang-like Protein 1/VANGL1 Protein

  • KAI1 C-terminal interacting tetraspanin
  • Loop-tail protein 2 homolog
  • LPP2
  • MGC5338
  • STB2
  • STB2KITENIN
  • STBM2
  • Strabismus 2
  • Van Gogh-like protein 1
  • vang (van gogh, Drosophila)-like 1, vang, van gogh-like 1 (Drosophila)
  • Vang like Protein 1
  • VANGL1
  • vang-like 1 (van gogh, Drosophila)
  • Vang-like Protein 1

Background

VANGL1 - vang-like 1 (van gogh, Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4815
Species: Hu, Mu, Rt
Applications: WB, IHC
AF6278
Species: Hu, Mu
Applications: WB
AF1927
Species: Hu
Applications: WB, IP, ICC
AF7164
Species: Hu
Applications: WB
NBP1-76775
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24648
Species: Hu, Mu, Rt, Pm
Applications: WB
NBP1-83967
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-45378
Species: Hu
Applications: WB, IHC
3669-WN/CF
Species: Mu
NBP1-30656
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NLS5103
Species: Hu, Bv, Ca
Applications: IHC-P, ICC
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-13230
Species: Hu
Applications: IHC, IHC-P
NBP2-57350
Species: Hu
Applications: WB, ICC/IF
MAB1001
Species: Hu, Mu
Applications: Flow, IHC, CyTOF-ready
H00081839-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Vang-like Protein 1/VANGL1 Partial Recombinant Protein (H00081839-Q01) (0)

There are no publications for Vang-like Protein 1/VANGL1 Partial Recombinant Protein (H00081839-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Vang-like Protein 1/VANGL1 Partial Recombinant Protein (H00081839-Q01) (0)

There are no reviews for Vang-like Protein 1/VANGL1 Partial Recombinant Protein (H00081839-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Vang-like Protein 1/VANGL1 Partial Recombinant Protein (H00081839-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Vang-like Protein 1/VANGL1 Products

Bioinformatics Tool for Vang-like Protein 1/VANGL1 Partial Recombinant Protein (H00081839-Q01)

Discover related pathways, diseases and genes to Vang-like Protein 1/VANGL1 Partial Recombinant Protein (H00081839-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Vang-like Protein 1/VANGL1 Partial Recombinant Protein (H00081839-Q01)

Discover more about diseases related to Vang-like Protein 1/VANGL1 Partial Recombinant Protein (H00081839-Q01).
 

Pathways for Vang-like Protein 1/VANGL1 Partial Recombinant Protein (H00081839-Q01)

View related products by pathway.

PTMs for Vang-like Protein 1/VANGL1 Partial Recombinant Protein (H00081839-Q01)

Learn more about PTMs related to Vang-like Protein 1/VANGL1 Partial Recombinant Protein (H00081839-Q01).
 

Research Areas for Vang-like Protein 1/VANGL1 Partial Recombinant Protein (H00081839-Q01)

Find related products by research area.

Blogs on Vang-like Protein 1/VANGL1

There are no specific blogs for Vang-like Protein 1/VANGL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Vang-like Protein 1/VANGL1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol VANGL1
Entrez