USP50 Antibody

Images

 
Immunohistochemistry-Paraffin: USP50 Antibody [NBP1-86247] Staining of human kidney shows strong cytoplasmic and extracellular positivity in cells of tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

USP50 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YHYSRRRSYEKGSTQRCCRKWITTETSIITQLFEEQLNYSIVCLKCEKCTYKNEVFTVFSLPIPSKYECSLRDCLQCF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
USP50
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10 - 1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
USP50 Protein (NBP1-86247PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for USP50 Antibody

  • inactive ubiquitin carboxyl-terminal hydrolase 50
  • Inactive ubiquitin-specific peptidase 50
  • ubiquitin specific peptidase 50
  • ubiquitin specific protease 50

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33506
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1649
Species: Hu, Mu, Rt
Applications: WB, ICC
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-86247
Species: Hu
Applications: IHC, IHC-P

Publications for USP50 Antibody (NBP1-86247) (0)

There are no publications for USP50 Antibody (NBP1-86247).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP50 Antibody (NBP1-86247) (0)

There are no reviews for USP50 Antibody (NBP1-86247). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for USP50 Antibody (NBP1-86247) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional USP50 Products

Bioinformatics Tool for USP50 Antibody (NBP1-86247)

Discover related pathways, diseases and genes to USP50 Antibody (NBP1-86247). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP50 Antibody (NBP1-86247)

Discover more about diseases related to USP50 Antibody (NBP1-86247).
 

Pathways for USP50 Antibody (NBP1-86247)

View related products by pathway.

Blogs on USP50

There are no specific blogs for USP50, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our USP50 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol USP50