USP43 Antibody

Images

 
Western Blot: USP43 Antibody [NBP2-88562] - Host: Rabbit. Target Name: USP43. Sample Type: Fetal Lung lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

USP43 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human USP43. Peptide sequence: KSSPPSPYMGFSGNSKDSRRGTSELDRPLQGTLTLLRSVFRKKENRRNER The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
USP43
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Western Blot 1.0 ug/ml
Application Notes
Use in IHC reported in scientific literature (PMID:33391437)
Publications
Read Publication using
NBP2-88562 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for USP43 Antibody

  • Deubiquitinating enzyme 43
  • EC 3.1.2.15
  • EC 3.4.19.12
  • FLJ30626
  • ubiquitin carboxyl-terminal hydrolase 43
  • ubiquitin specific peptidase 43
  • ubiquitin specific protease 43
  • ubiquitin thioesterase 43
  • Ubiquitin thiolesterase 43
  • Ubiquitin-specific-processing protease 43

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-94624
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-05634
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-95223
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-88562
Species: Hu
Applications: WB, IHC

Publications for USP43 Antibody (NBP2-88562)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for USP43 Antibody (NBP2-88562) (0)

There are no reviews for USP43 Antibody (NBP2-88562). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for USP43 Antibody (NBP2-88562) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional USP43 Products

Array NBP2-88562

Bioinformatics Tool for USP43 Antibody (NBP2-88562)

Discover related pathways, diseases and genes to USP43 Antibody (NBP2-88562). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on USP43

There are no specific blogs for USP43, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our USP43 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol USP43