Recombinant Human UGT2B15 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human UGT2B15 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 85-160 of Human UGT2B15 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYYDYSNKLCKDAVLNKKLMMKLQESKFDVILADALNPCGEL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
UGT2B15
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human UGT2B15 Protein

  • EC 2.4.1
  • EC 2.4.1.17
  • HLUG4
  • UDP glucuronosyltransferase 2 family, polypeptide B15
  • UDP glycosyltransferase 2 family, polypeptide B15
  • UDP glycosyltransferase 2B15
  • UDP-glucuronosyltransferase 2B15
  • UDP-glucuronosyltransferase 2B8
  • UDP-glucuronosyltransferase UGT2B15
  • UDP-glucuronyltransferase, family 2, beta-15
  • UDPGT 2B15
  • UDPGT 2B8
  • UDPGTH3
  • UDPGTh-3
  • UGT2B8UDPGT2B15

Background

The UGTs are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. UGT2B8 demonstrates reactivity with estriol. See UGT2B4 (MIM 600067).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00007364-M02-100ug
Species: Hu, Rt
Applications: WB, ELISA
AF6490
Species: Hu
Applications: WB, IHC, ICC
H00054600-B01P
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-33743
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00054659-M02
Species: Hu
Applications: WB, ELISA
H00007363-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-69412
Species: Hu
Applications: WB
NBP1-72063
Species: Rt
Applications: WB, PEP-ELISA
NBP2-06724
Species: Hu
NBP1-91335
Species: Hu
Applications: WB, ICC/IF, IHC
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-03227
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91818
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-08443
Species: Hu
NBP1-59786
Species: Hu
Applications: WB
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007366-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for UGT2B15 Partial Recombinant Protein (H00007366-Q01) (0)

There are no publications for UGT2B15 Partial Recombinant Protein (H00007366-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UGT2B15 Partial Recombinant Protein (H00007366-Q01) (0)

There are no reviews for UGT2B15 Partial Recombinant Protein (H00007366-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UGT2B15 Partial Recombinant Protein (H00007366-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UGT2B15 Products

Bioinformatics Tool for UGT2B15 Partial Recombinant Protein (H00007366-Q01)

Discover related pathways, diseases and genes to UGT2B15 Partial Recombinant Protein (H00007366-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UGT2B15 Partial Recombinant Protein (H00007366-Q01)

Discover more about diseases related to UGT2B15 Partial Recombinant Protein (H00007366-Q01).
 

Pathways for UGT2B15 Partial Recombinant Protein (H00007366-Q01)

View related products by pathway.

PTMs for UGT2B15 Partial Recombinant Protein (H00007366-Q01)

Learn more about PTMs related to UGT2B15 Partial Recombinant Protein (H00007366-Q01).

Blogs on UGT2B15

There are no specific blogs for UGT2B15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human UGT2B15 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol UGT2B15