Recombinant Human TWF2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TWF2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 131-230 of Human PTK9L partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:FAGYQKHLSSCAAPAPLTSAERELQQIRINEVKTEISVESKHQTLQGLAFPLQPEAQRALQQLKQKMVNYIQMKLDLERETIELVHTEPTDVAQLPSRVP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TWF2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TWF2 Protein

  • A6-related protein
  • A6RPFLJ56277
  • hA6RP
  • protein tyrosine kinase 9-like (A6-related protein)
  • Protein tyrosine kinase 9-like
  • PTK9L protein tyrosine kinase 9-like (A6-related protein)
  • PTK9LA6r
  • twinfilin, actin-binding protein, homolog 2 (Drosophila)
  • Twinfilin-1-like protein
  • twinfilin-2

Background

PTK9L - PTK9L protein tyrosine kinase 9-like (A6-related protein)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90297
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF3966
Species: Hu
Applications: WB, IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP2-00527
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for TWF2 Partial Recombinant Protein (H00011344-Q01) (0)

There are no publications for TWF2 Partial Recombinant Protein (H00011344-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TWF2 Partial Recombinant Protein (H00011344-Q01) (0)

There are no reviews for TWF2 Partial Recombinant Protein (H00011344-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TWF2 Partial Recombinant Protein (H00011344-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TWF2 Products

Bioinformatics Tool for TWF2 Partial Recombinant Protein (H00011344-Q01)

Discover related pathways, diseases and genes to TWF2 Partial Recombinant Protein (H00011344-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for TWF2 Partial Recombinant Protein (H00011344-Q01)

View related products by pathway.

PTMs for TWF2 Partial Recombinant Protein (H00011344-Q01)

Learn more about PTMs related to TWF2 Partial Recombinant Protein (H00011344-Q01).
 

Research Areas for TWF2 Partial Recombinant Protein (H00011344-Q01)

Find related products by research area.

Blogs on TWF2

There are no specific blogs for TWF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TWF2 Antibody
NBP2-27171

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TWF2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TWF2