TTLL11 Antibody

Images

 
Western Blot: TTLL11 Antibody [NBP2-14495] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Testis
Immunohistochemistry-Paraffin: TTLL11 Antibody [NBP2-14495] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TTLL11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VRKITLSRAVRTMQNLFPEEYNFYPRSWILPDEFQLFVAQVQMVKDDDPS WKPTFIVKPDGGCQGDGIYLIKDPSDIRLAGTLQSRPAVVQEY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TTLL11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TTLL11 Protein (NBP2-14495PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TTLL11 Antibody

  • bA244O19.1
  • C9orf20
  • RP11-429D3.1
  • TTLL11 tubulin tyrosine ligase-like family, member 11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-40773
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83671
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-14495
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TTLL11 Antibody (NBP2-14495) (0)

There are no publications for TTLL11 Antibody (NBP2-14495).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TTLL11 Antibody (NBP2-14495) (0)

There are no reviews for TTLL11 Antibody (NBP2-14495). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TTLL11 Antibody (NBP2-14495) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TTLL11 Products

TTLL11 NBP2-14495

Bioinformatics Tool for TTLL11 Antibody (NBP2-14495)

Discover related pathways, diseases and genes to TTLL11 Antibody (NBP2-14495). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TTLL11 Antibody (NBP2-14495)

Discover more about diseases related to TTLL11 Antibody (NBP2-14495).
 

Pathways for TTLL11 Antibody (NBP2-14495)

View related products by pathway.

Blogs on TTLL11

There are no specific blogs for TTLL11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TTLL11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TTLL11