Recombinant Human TRIML1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TRIML1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 369 - 468 of Human FLJ36180 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PKPPGDLFSLIGLKIGDDYSLWVSSPLKGQHVREPVCKVGVFLDYESGHIAFYNGTDESLIYSFPQASFQEALRPIFSPCLPNEGTNTDPLTICSLNSHV

Protein/Peptide Type
Partial Recombinant Protein
Gene
TRIML1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TRIML1 Protein

  • EC 6.3.2.-
  • FLJ36180
  • MGC138638
  • probable E3 ubiquitin-protein ligase TRIML1
  • RING finger protein 209
  • RNF209MGC138639
  • tripartite motif family-like 1
  • Tripartite motif family-like protein 1

Background

FLJ36180 - hypothetical protein FLJ36180

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14327
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14617
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3075
Species: Hu
Applications: WB, ICC
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13169
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-31576
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02648
Species: Hu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-60150
Species: Hu, Mu, Rt
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-86304
Species: Hu
Applications: IHC, IHC-P

Publications for TRIML1 Partial Recombinant Protein (H00339976-Q01) (0)

There are no publications for TRIML1 Partial Recombinant Protein (H00339976-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIML1 Partial Recombinant Protein (H00339976-Q01) (0)

There are no reviews for TRIML1 Partial Recombinant Protein (H00339976-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRIML1 Partial Recombinant Protein (H00339976-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRIML1 Products

Bioinformatics Tool for TRIML1 Partial Recombinant Protein (H00339976-Q01)

Discover related pathways, diseases and genes to TRIML1 Partial Recombinant Protein (H00339976-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIML1 Partial Recombinant Protein (H00339976-Q01)

Discover more about diseases related to TRIML1 Partial Recombinant Protein (H00339976-Q01).

Research Areas for TRIML1 Partial Recombinant Protein (H00339976-Q01)

Find related products by research area.

Blogs on TRIML1

There are no specific blogs for TRIML1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TRIML1 Antibody (4F8)
H00339976-M01
ASGPR1 Antibody (8D7)
NBP1-60150-0.025mg

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TRIML1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIML1