TPRG1 Antibody

Images

 
Western Blot: TPRG1 Antibody [NBP1-56560] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Rt, CaSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TPRG1 Antibody Summary

Immunogen
Synthetic peptides corresponding to FAM79B The peptide sequence was selected from the N terminal of FAM79B. Peptide sequence DPMPRQISRQSSVTESTLYPNPYHQPYISRKYFATRPGAIETAMEDLKGH. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (92%), Canine (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TPRG1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against FAM79B and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TPRG1 Antibody

  • FAM79B
  • FLJ41238
  • FLJ43694
  • member B
  • MGC126599
  • MGC126601
  • Protein FAM79B
  • tumor protein p63 regulated 1
  • tumor protein p63-regulated gene 1 protein

Background

The specific function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5956
Species: Hu, Mu
Applications: WB
NBP2-46085
Species: Hu
Applications: WB, IHC
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF3184
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NBP1-89549
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TPRG1 Antibody (NBP1-56560) (0)

There are no publications for TPRG1 Antibody (NBP1-56560).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TPRG1 Antibody (NBP1-56560) (0)

There are no reviews for TPRG1 Antibody (NBP1-56560). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TPRG1 Antibody (NBP1-56560) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TPRG1 Products

Bioinformatics Tool for TPRG1 Antibody (NBP1-56560)

Discover related pathways, diseases and genes to TPRG1 Antibody (NBP1-56560). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TPRG1 Antibody (NBP1-56560)

Discover more about diseases related to TPRG1 Antibody (NBP1-56560).

Blogs on TPRG1

There are no specific blogs for TPRG1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TPRG1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TPRG1
Uniprot