TMPRSS11A Antibody

Images

 
Western Blot: TMPRSS11A Antibody [NBP2-84307] - Host: Rabbit. Target Name: TMPRSS11A. Sample Tissue: Human HepG2 Whole Cell. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity Hu, Po, Bv, Eq, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMPRSS11A Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TMPRSS11A. Peptide sequence: YDACRGDSGGPLVTRDLKDTWYLIGIVSWGDNCGQKDKPGVYTQVTYYRN The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Porcine (93%), Rabbit (100%), Bovine (93%), Zebrafish (92%), Equine (93%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
TMPRSS11A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TMPRSS11A Antibody

  • Airway Trypsin-Like Protease 1
  • EC 3.4.21
  • EC 3.4.21.
  • ECRG1
  • Epidermal Type II Transmembrane Serine Protease
  • Epidermal Type-II Transmembrane Serine Protease
  • Esophageal Cancer-Susceptibility Gene 1 Protein
  • HATL1
  • HESP
  • Transmembrane Protease Serine 11A
  • Transmembrane Protease, Serine 11A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84911
Species: Hu, Rt
Applications: WB, IHC, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP2-37888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47485
Species: Hu
Applications: WB, IHC, IHC-P
AF3760
Species: Hu
Applications: WB
NBP2-67484
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-79827
Species: Hu, Mu
Applications: WB, IP
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi, S-ELISA
AF1107
Species: Mu
Applications: WB, IHC
NBP1-82454
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00003347-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-84307
Species: Hu, Po, Bv, Eq, Rb, Ze
Applications: WB

Publications for TMPRSS11A Antibody (NBP2-84307) (0)

There are no publications for TMPRSS11A Antibody (NBP2-84307).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMPRSS11A Antibody (NBP2-84307) (0)

There are no reviews for TMPRSS11A Antibody (NBP2-84307). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMPRSS11A Antibody (NBP2-84307) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TMPRSS11A Products

Array NBP2-84307

Bioinformatics Tool for TMPRSS11A Antibody (NBP2-84307)

Discover related pathways, diseases and genes to TMPRSS11A Antibody (NBP2-84307). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMPRSS11A Antibody (NBP2-84307)

Discover more about diseases related to TMPRSS11A Antibody (NBP2-84307).
 

Pathways for TMPRSS11A Antibody (NBP2-84307)

View related products by pathway.

PTMs for TMPRSS11A Antibody (NBP2-84307)

Learn more about PTMs related to TMPRSS11A Antibody (NBP2-84307).

Blogs on TMPRSS11A

There are no specific blogs for TMPRSS11A, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMPRSS11A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMPRSS11A