TMEM241 Antibody


Western Blot: TMEM241 Antibody [NBP2-56668] - Western blot analysis in human cell line RT-4, human cell line U-251 MG and human plasma.
Immunocytochemistry/ Immunofluorescence: TMEM241 Antibody [NBP2-56668] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF

Order Details

TMEM241 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SRLAIPVFLTLHNVAEVIICGYQKCFQKEKTSPAKICSALLLLAAAGCLPFNDSQGLIKFYRSPRNPVH
Specificity of human TMEM241 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TMEM241 Recombinant Protein Antigen (NBP2-56668PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, containing 40% glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for TMEM241 Antibody

  • C18orf45
  • Chromosome 18 Open Reading Frame 45
  • hVVT
  • Putative Vertebrate Vrg4-Like Nucleotide-Sugar Transporter Truncated Variant2
  • Putative Vertebrate Vrg4-Like Nucleotide-Sugar Transporter Variant1
  • Transmembrane Protein 241
  • Transmembrane Protein C18orf45


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IF
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, ICC/IF

Publications for TMEM241 Antibody (NBP2-56668) (0)

There are no publications for TMEM241 Antibody (NBP2-56668).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM241 Antibody (NBP2-56668) (0)

There are no reviews for TMEM241 Antibody (NBP2-56668). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TMEM241 Antibody (NBP2-56668) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for TMEM241 Antibody (NBP2-56668)

Discover related pathways, diseases and genes to TMEM241 Antibody (NBP2-56668). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TMEM241

There are no specific blogs for TMEM241, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TMEM241 Antibody and receive a gift card or discount.


Gene Symbol TMEM241