TMEM241 Antibody

Images

 
Western Blot: TMEM241 Antibody [NBP2-56668] - Analysis in human cell line RT-4, human cell line U-251 MG and human plasma.
Immunocytochemistry/ Immunofluorescence: TMEM241 Antibody [NBP2-56668] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEM241 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SRLAIPVFLTLHNVAEVIICGYQKCFQKEKTSPAKICSALLLLAAAGCLPFNDSQGLIKFYRSPRNPVH
Specificity
Specificity of human TMEM241 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM241
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TMEM241 Recombinant Protein Antigen (NBP2-56668PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TMEM241 Antibody

  • C18orf45
  • Chromosome 18 Open Reading Frame 45
  • hVVT
  • Putative Vertebrate Vrg4-Like Nucleotide-Sugar Transporter Truncated Variant2
  • Putative Vertebrate Vrg4-Like Nucleotide-Sugar Transporter Variant1
  • Transmembrane Protein 241
  • Transmembrane Protein C18orf45

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1543
Species: Hu
Applications: WB, IHC
NBP1-88917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP2-45970
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IF
NBP2-57809
Species: Hu
Applications: ICC/IF
NBP2-56668
Species: Hu
Applications: WB, ICC/IF

Publications for TMEM241 Antibody (NBP2-56668) (0)

There are no publications for TMEM241 Antibody (NBP2-56668).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM241 Antibody (NBP2-56668) (0)

There are no reviews for TMEM241 Antibody (NBP2-56668). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TMEM241 Antibody (NBP2-56668) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for TMEM241 Antibody (NBP2-56668)

Discover related pathways, diseases and genes to TMEM241 Antibody (NBP2-56668). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TMEM241

There are no specific blogs for TMEM241, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM241 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM241