TMED3 Antibody - BSA Free

Western Blot: TMED3 Antibody [NBP1-69575] - This Anti-TMED3 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 2.5ug/ml.

Product Discontinued

TMED3 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to TMED3(transmembrane emp24 protein transport domain containing 3) The peptide sequence was selected from the C terminal of TMED3. Peptide sequence DRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLKSFFTEKRPISRAVHS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMED3
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for TMED3 Antibody - BSA Free

• C15orf22
• chromosome 15 open reading frame 22
• integral type I protein
• Membrane protein p24B
• MGC133022
• P24B
• transmembrane emp24 domain containing 3
• transmembrane emp24 domain-containing protein 3
• transmembrane emp24 protein transport domain containing 3,1200002G13Rik

Background

The function remains known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TMED3
• Uniprot:
  • Q9Y3Q3(Human)