TMED3 Antibody


Western Blot: TMED3 Antibody [NBP1-69575] - This Anti-TMED3 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 2.5ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

TMED3 Antibody Summary

Synthetic peptides corresponding to TMED3(transmembrane emp24 protein transport domain containing 3) The peptide sequence was selected from the C terminal of TMED3. Peptide sequence DRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLKSFFTEKRPISRAVHS.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TMED3 and was validated on Western blot.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TMED3 Antibody

  • C15orf22
  • chromosome 15 open reading frame 22
  • integral type I protein
  • Membrane protein p24B
  • MGC133022
  • P24B
  • transmembrane emp24 domain containing 3
  • transmembrane emp24 domain-containing protein 3
  • transmembrane emp24 protein transport domain containing 3,1200002G13Rik


The function remains known.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, IHC
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Flow, IHC
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, Flow-IC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
Species: Hu
Applications: WB

Publications for TMED3 Antibody (NBP1-69575) (0)

There are no publications for TMED3 Antibody (NBP1-69575).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMED3 Antibody (NBP1-69575) (0)

There are no reviews for TMED3 Antibody (NBP1-69575). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMED3 Antibody (NBP1-69575) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TMED3 Products

Bioinformatics Tool for TMED3 Antibody (NBP1-69575)

Discover related pathways, diseases and genes to TMED3 Antibody (NBP1-69575). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMED3 Antibody (NBP1-69575)

Discover more about diseases related to TMED3 Antibody (NBP1-69575).

Pathways for TMED3 Antibody (NBP1-69575)

View related products by pathway.

Blogs on TMED3

There are no specific blogs for TMED3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TMED3 Antibody and receive a gift card or discount.


Gene Symbol TMED3