TIP60 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TIP60 Source: E.coli
Amino Acid Sequence: YWSQTILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKR Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
KAT5 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10-100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25195It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for TIP60 Recombinant Protein Antigen
Background
HTATIP (HIV-1 Tat interacting protein TIP60, about 60kDa) belongs to the MYST family of histone acetyl transferases (HATs) and was originally isolated as an HIV-1 TAT-interactive protein. HATs play important roles in regulating chromatin remodeling, transcription and other nuclear processes by acetylating histone and nonhistone proteins. The nucleosome, made up of four core histone proteins (H2A, H2B, H3 and H4), is the primary building block of chromatin. In addition to the growing number of post-translational histone modifications regulating chromatin structure, cells can also exchange canonical histones with variant histones that can directly or indirectly modulate chromatin structure. There are five major variants of histone H2A: canonical H2A (most abundant), H2A.X, MacroH2A, H2ABbd and H2A.Z. Histone H2A.Z, the most conserved variant across species, functions as both a positive and negative regulator of transcription and is important for chromosome stability. Several homologous protein complexes, such as SWR-C, TIP60 and SRCAP (mammals), have been shown to catalyze the ATP-dependent exchange of H2A.Z for H2A in the nucleosome. This protein is a histone acetylase that has a role in DNA repair and apoptosis and is thought to play an important role in signal transduction.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: IP, WB
Species: Hu, Mu
Applications: ELISA, IHC, WB
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: AC
Publications for TIP60 Recombinant Protein Antigen (NBP3-25195PEP) (0)
There are no publications for TIP60 Recombinant Protein Antigen (NBP3-25195PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TIP60 Recombinant Protein Antigen (NBP3-25195PEP) (0)
There are no reviews for TIP60 Recombinant Protein Antigen (NBP3-25195PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for TIP60 Recombinant Protein Antigen (NBP3-25195PEP) (0)
Additional TIP60 Products
Research Areas for TIP60 Recombinant Protein Antigen (NBP3-25195PEP)
Find related products by research area.
|
Blogs on TIP60