TIGD3 Antibody


Western Blot: TIGD3 Antibody [NBP1-70724] - Titration: 1.25ug/ml Positive Control: Jurkat cell lysate.

Product Details

Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB

Order Details

TIGD3 Antibody Summary

Synthetic peptides corresponding to TIGD3(tigger transposable element derived 3) The peptide sequence was selected from the N terminal of TIGD3. Peptide sequence NKEKLLADWCSGTANRERKRKRESKYSGIDEALLCWYHIARAKAWDVTGP. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Bovine (100%), Guinea Pig (100%), Rabbit (93%). Backed by our 100% Guarantee.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TIGD3 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TIGD3 Antibody

  • tigger transposable element derived 3
  • tigger transposable element-derived protein 3


TIGD3 belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function of TIGD3 gene is not known.The protein encoded by this gene belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function of this gene is not known.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ze
Applications: WB, IHC, IHC-P, Flow-IC
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb
Applications: WB

Publications for TIGD3 Antibody (NBP1-70724) (0)

There are no publications for TIGD3 Antibody (NBP1-70724).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIGD3 Antibody (NBP1-70724) (0)

There are no reviews for TIGD3 Antibody (NBP1-70724). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TIGD3 Antibody (NBP1-70724) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional TIGD3 Products

Array NBP1-70724

Bioinformatics Tool for TIGD3 Antibody (NBP1-70724)

Discover related pathways, diseases and genes to TIGD3 Antibody (NBP1-70724). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TIGD3

There are no specific blogs for TIGD3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TIGD3 Antibody and receive a gift card or discount.


Gene Symbol TIGD3