![Western Blot: THEG Antibody [NBP1-79692] - Human Heart lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/fullsize2/THEG-Antibody-Western-Blot-NBP1-79692-img0002.jpg "Western Blot: THEG Antibody [NBP1-79692] - Human Heart lysate, concentration 0.2-1 ug/ml.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Synthetic peptide directed towards the middle region of human THEG. Peptide sequence: LKDRPSVYWTERFLEDTTLTITVPAVSRRVEELSRPKRFYLEYYNNNRTT The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | THEG |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This is a rabbit polyclonal antibody against THEG and was validated on Western blot. |
| Theoretical MW | 41 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
-Immunohistochemistry-NBP2-45545-img0001.jpg)
-Immunohistochemistry-NBP2-45545-img0002.jpg)
-Immunohistochemistry-NBP2-45545-img0003.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for THEG Antibody (NBP1-79692)Discover more about diseases related to THEG Antibody (NBP1-79692).
| Pathways for THEG Antibody (NBP1-79692)View related products by pathway.
|
PTMs for THEG Antibody (NBP1-79692)Learn more about PTMs related to THEG Antibody (NBP1-79692).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
-Immunohistochemistry-Paraffin-NBP1-47659-img0012.jpg)
-Immunohistochemistry-Paraffin-NBP1-47659-img0013.jpg)
-Immunohistochemistry-Paraffin-NBP1-47659-img0014.jpg)
![Western Blot Galectin-10 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin-10_AF5447_Western_Blot_5721.jpg)
![Intracellular Staining by Flow Cytometry Galectin-10 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin-10_AF5447_Flow_Cytometry_8273.jpg)
![Intracellular Staining by Flow Cytometry Galectin-10 Antibody [Unconjugated]](https://images.novusbio.com/images2/af5447_human-galectin-10-affinity-purified-polyclonal-ab-flow-cytometry-2162021133613.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")