TCEAL8 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TCEAL8 Antibody [NBP2-32425] - Immunofluorescent staining of human cell line RH-30 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: TCEAL8 Antibody [NBP2-32425] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TCEAL8 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PQNMPKAEEDRPLEDVPQEAEGNPQPSEEGVSQEAEGNPRGGPNQPGQGFKEDTPVRHLDPEEMIRGVDELERLREEIRRVRNKFVMMHWKQRHSRSRPYPVCFR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TCEAL8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TCEAL8 Protein (NBP2-32425PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TCEAL8 Antibody

  • MGC45400
  • TCEA-like protein 8
  • transcription elongation factor A (SII)-like 8
  • transcription elongation factor A protein-like 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86142
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90276
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32013
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P
NBP2-02729
Species: Hu
Applications: WB, ICC/IF
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-88842
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30887
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33807
Species: Hu
Applications: WB, IHC, IHC-P
AF1212
Species: Hu, Mu
Applications: WB, IHC, ICC, Neut
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-585
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP2-00513
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for TCEAL8 Antibody (NBP2-32425) (0)

There are no publications for TCEAL8 Antibody (NBP2-32425).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCEAL8 Antibody (NBP2-32425) (0)

There are no reviews for TCEAL8 Antibody (NBP2-32425). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TCEAL8 Antibody (NBP2-32425) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TCEAL8 Products

Bioinformatics Tool for TCEAL8 Antibody (NBP2-32425)

Discover related pathways, diseases and genes to TCEAL8 Antibody (NBP2-32425). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCEAL8 Antibody (NBP2-32425)

Discover more about diseases related to TCEAL8 Antibody (NBP2-32425).

Blogs on TCEAL8

There are no specific blogs for TCEAL8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TCEAL8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TCEAL8