SYT15 Antibody - BSA Free

Western Blot: SYT15 Antibody [NBP2-85862] - Host: Rabbit. Target Name: SYT15. Sample Tissue: Mouse Pancreas lysates. Antibody Dilution: 1ug/ml

Product Discontinued

SYT15 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SYT15 Antibody - BSA Free (NBP2-85862) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse SYT15. Peptide sequence: KKRKHQLLGQVLFPLKNETLAGDHHRIIWRDLEAKNLEPPSEFGDIQFCL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SYT15
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SYT15 Antibody - BSA Free

• synaptotagmin-15
• CHR10SYT
• synaptotagmin XV
• sytXV

Background

The SYT15 gene encodes a member of the Synaptotagmin (Syt) family of membrane trafficking proteins. Members of this familycontain a transmembrane region and a C-terminal-type tandem C2 domain. Unlike related family members, the encodedprotein may be involved i

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SYT15