SWSAP1 Antibody

Images

 
Immunohistochemistry: SWSAP1 Antibody [NBP2-30909] - Staining of human kidney shows strong nuclear positivity in renal tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SWSAP1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EGQGPVLFLTRRPLQSMPRGTGTTLDPMRLQKIRFQYPPSTRELFRLLCSAHEAPGPAPSLLLLDGLEEYLAEDPEPQEAAYLIALLLD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SWSAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SWSAP1 Protein (NBP2-30909PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SWSAP1 Antibody

  • ATPase SWSAP1
  • C19orf39
  • Chromosome 19 Open Reading Frame 39
  • SWIM-Type Containing 7 Associated Protein 1
  • SWIM-Type Zinc Finger 7 Associated Protein 1
  • SWIM-Type Zinc Finger 7-Associated Protein 1
  • SWS1AP1
  • SWS1-Associated Protein 1
  • Zinc Finger
  • Zinc Finger, SWIM-Type Containing 7 Associated Protein 1
  • ZSWIM7AP1
  • ZSWIM7-Associated Protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1477
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro

Publications for SWSAP1 Antibody (NBP2-30909) (0)

There are no publications for SWSAP1 Antibody (NBP2-30909).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SWSAP1 Antibody (NBP2-30909) (0)

There are no reviews for SWSAP1 Antibody (NBP2-30909). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SWSAP1 Antibody (NBP2-30909) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SWSAP1 Products

SWSAP1 NBP2-30909

Bioinformatics Tool for SWSAP1 Antibody (NBP2-30909)

Discover related pathways, diseases and genes to SWSAP1 Antibody (NBP2-30909). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SWSAP1

There are no specific blogs for SWSAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SWSAP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SWSAP1
Uniprot