SULT1A2 Recombinant Protein Antigen

Images

 
There are currently no images for SULT1A2 Protein (NBP2-31904PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SULT1A2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SULT1A2.

Source: E.coli

Amino Acid Sequence: ELIQDISRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLL

Protein/Peptide Type
Recombinant Protein Antigen
Gene
SULT1A2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-31904.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SULT1A2 Recombinant Protein Antigen

  • Aryl sulfotransferase 2
  • arylamine sulfotransferase
  • EC 2.8.2
  • EC 2.8.2.1
  • HAST4
  • MGC142287
  • MGC142289
  • Phenol sulfotransferase 2
  • phenolic-metabolizing (P) form of PST
  • phenol-preferring phenol sulfotransferase2
  • Phenol-sulfating phenol sulfotransferase 2
  • P-PST 2
  • ST1A2
  • STP2P-PST
  • sulfotransferase 1A2
  • sulfotransferase family, cytosolic, 1A, phenol-preferring, member 2
  • thermostable phenol sulfotransferase
  • TSPST2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03227
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-11538
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP2-29951
Species: Hu, Mu
Applications: WB, Flow, IHC-P
NBP1-84785
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF5828
Species: Hu
Applications: WB, ICC, Neut
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-00486
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-59786
Species: Hu
Applications: WB
NBP2-59311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-30868
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33751
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00900
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87008
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58195
Species: Hu
Applications: ICC/IF

Publications for SULT1A2 Protein (NBP2-31904PEP) (0)

There are no publications for SULT1A2 Protein (NBP2-31904PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SULT1A2 Protein (NBP2-31904PEP) (0)

There are no reviews for SULT1A2 Protein (NBP2-31904PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for SULT1A2 Protein (NBP2-31904PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SULT1A2 Products

Bioinformatics Tool for SULT1A2 Protein (NBP2-31904PEP)

Discover related pathways, diseases and genes to SULT1A2 Protein (NBP2-31904PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SULT1A2 Protein (NBP2-31904PEP)

Discover more about diseases related to SULT1A2 Protein (NBP2-31904PEP).
 

Pathways for SULT1A2 Protein (NBP2-31904PEP)

View related products by pathway.

PTMs for SULT1A2 Protein (NBP2-31904PEP)

Learn more about PTMs related to SULT1A2 Protein (NBP2-31904PEP).

Blogs on SULT1A2

There are no specific blogs for SULT1A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SULT1A2 Antibody
NBP2-31904
SULT1A2 Antibody
NBP2-31904

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SULT1A2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SULT1A2