STAC3 Antibody - BSA Free

Western Blot: STAC3 Antibody [NBP2-85835] - Host: Rabbit. Target Name: STAC3. Sample Type: HepG2 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

STAC3 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human STAC3. Peptide sequence: RPEEGKPQDGNPEGDKKAEKKTPDDKHKQPGFQQSHYFVALYRFKALEKD The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STAC3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for STAC3 Antibody - BSA Free

• MGC2793
• SH3 and cysteine rich domain 3
• SH3 and cysteine-rich domain-containing protein 3

Background

STAC3 is a gene that codes for a protein 364 amino acids in length, with a weight of approximately 42 kDa and a shorter isoform that is 325 amino acids in length and a weight of approximately 37 kDa. STAC3 has been shown to have interactions with ZCCHC10, PPARA, and ENKD1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STAC3