SS18L2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SS18L2 Antibody [NBP2-13386] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus, nucleoli & mitochondria.
Immunohistochemistry-Paraffin: SS18L2 Antibody [NBP2-13386] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SS18L2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VAFVPDWLRGKAEVNQETIQRLLEENDQLIRCIVEYQNKGRGNECVQYQH VLH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SS18L2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SS18L2 Protein (NBP2-13386PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SS18L2 Antibody

  • KIAA-iso
  • SS18-like protein 2
  • synovial sarcoma translocation gene on chromosome 18-like 2
  • SYT homolog 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006760-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00001719-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
H00006757-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-13386
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for SS18L2 Antibody (NBP2-13386) (0)

There are no publications for SS18L2 Antibody (NBP2-13386).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SS18L2 Antibody (NBP2-13386) (0)

There are no reviews for SS18L2 Antibody (NBP2-13386). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SS18L2 Antibody (NBP2-13386) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SS18L2 Products

Bioinformatics Tool for SS18L2 Antibody (NBP2-13386)

Discover related pathways, diseases and genes to SS18L2 Antibody (NBP2-13386). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SS18L2 Antibody (NBP2-13386)

Discover more about diseases related to SS18L2 Antibody (NBP2-13386).

Research Areas for SS18L2 Antibody (NBP2-13386)

Find related products by research area.

Blogs on SS18L2

There are no specific blogs for SS18L2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SS18L2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SS18L2