SPTBN4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SPTBN4 Antibody [NBP2-49131] - Staining of human cell line U-2 OS shows localization to nucleus, nucleoli & cytosol.
Immunohistochemistry: SPTBN4 Antibody [NBP2-49131] - Staining of human cerebral cortex shows cytoplasmic positivity in processes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPTBN4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids:AWEERFSSLRRLTTIEKIKAEQSKQPPTPLLGRKFFGDPTELAAKAAPLLRPGGYERGLEPLARRASDTLSAEVRTRVGYVRQELKPERLQPRIDRLP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPTBN4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SPTBN4 Recombinant Protein Antigen (NBP2-49131PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPTBN4 Antibody

  • beta-IV spectrin
  • KIAA1642
  • QV
  • spectrin beta chain, brain 3
  • spectrin, beta, non-erythrocytic 4
  • spectrin, non-erythroid beta chain 3
  • SPNB4
  • SPTBN3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87441
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003736-B01P
Species: Hu
Applications: WB
NBP1-42802
Species: Hu, Mu, Rt, Po, Bv, Ca, Xp, Ze
Applications: WB, ICC/IF, IP
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-88645
Species: Hu
Applications: IHC, IHC-P

Publications for SPTBN4 Antibody (NBP2-49131) (0)

There are no publications for SPTBN4 Antibody (NBP2-49131).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPTBN4 Antibody (NBP2-49131) (0)

There are no reviews for SPTBN4 Antibody (NBP2-49131). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SPTBN4 Antibody (NBP2-49131) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPTBN4 Products

SPTBN4 NBP2-49131

Bioinformatics Tool for SPTBN4 Antibody (NBP2-49131)

Discover related pathways, diseases and genes to SPTBN4 Antibody (NBP2-49131). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SPTBN4

There are no specific blogs for SPTBN4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPTBN4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPTBN4