Sperm Flagellar 2 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: LGTITFEQYMQAGLWFTGDEDIKIPENPLEPLPFNRQEHLIEFFFRLFADYEKDPPQLDYTQMLLYFACHPDTVEGVYRALSVAVGTHVFQQVKA |
| Predicted Species |
Rat (91%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SPEF2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:2500 - 1:5000
- Immunohistochemistry-Paraffin 1:2500 - 1:5000
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Sperm Flagellar 2 Antibody - BSA Free
Background
The SPEF2 gene encodes a sperm flagellar protein 2 that exists in four isoforms. Isoform 1 is 1,822 amino acids long at 209 kDA, isoform 2 is 1,818 amino acids long at 209 kDA, isoform 3 is 514 amino acids long at 61 kDA, and isoform 4 is 619 amino acids long at 70 kDA. The protein encoded by the SPEF2 gene is thought to be critical to correct axoneme development. This gene interacts with genes APOA1 and IGHA1. SPEF2 has been linked to diseases such as primary ciliary dyskinesia and infertility.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Eq, Ha, Hu, Mu, Po, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: IHC
Publications for Sperm Flagellar 2 Antibody (NBP2-38461) (0)
There are no publications for Sperm Flagellar 2 Antibody (NBP2-38461).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Sperm Flagellar 2 Antibody (NBP2-38461) (0)
There are no reviews for Sperm Flagellar 2 Antibody (NBP2-38461).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Sperm Flagellar 2 Antibody (NBP2-38461) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Sperm Flagellar 2 Products
Blogs on Sperm Flagellar 2