SPECC1L Antibody


Western Blot: SPECC1L Antibody [NBP2-49640] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MG
Immunocytochemistry/ Immunofluorescence: SPECC1L Antibody [NBP2-49640] - Immunofluorescent staining of human cell line SiHa shows localization to actin filaments.
Immunohistochemistry-Paraffin: SPECC1L Antibody [NBP2-49640] - Staining of human kidney shows moderate cytoplasmic positivity in subset of renal tubules.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

SPECC1L Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: QRHSISGPISTSKPLTALSDKRPNYGEIPVQEHLLRTSSASRPASLPRVPAMESAKT
Specificity of human SPECC1L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (93%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SPECC1L Recombinant Protein Antigen (NBP2-49640PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SPECC1L Antibody

  • Cytokinesis And Spindle Organization A
  • Cytospin A
  • GBBB2
  • KIAA0376
  • OBLFC1
  • Renal Carcinoma Antigen NY-REN-22
  • SPECC1-Like Protein
  • SPECC1-Like
  • Sperm Antigen With Calponin Homology And Coiled-Coil Domains 1-Like


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt, Xp
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Pm, Rb
Applications: WB, ICC/IF

Publications for SPECC1L Antibody (NBP2-49640) (0)

There are no publications for SPECC1L Antibody (NBP2-49640).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPECC1L Antibody (NBP2-49640) (0)

There are no reviews for SPECC1L Antibody (NBP2-49640). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SPECC1L Antibody (NBP2-49640) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional SPECC1L Products

Bioinformatics Tool for SPECC1L Antibody (NBP2-49640)

Discover related pathways, diseases and genes to SPECC1L Antibody (NBP2-49640). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPECC1L Antibody (NBP2-49640)

Discover more about diseases related to SPECC1L Antibody (NBP2-49640).

Pathways for SPECC1L Antibody (NBP2-49640)

View related products by pathway.

Blogs on SPECC1L

There are no specific blogs for SPECC1L, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SPECC1L Antibody and receive a gift card or discount.


Gene Symbol SPECC1L