![Western Blot: SLC35B1 Antibody [NBP1-69299] - This Anti-SLC35B1 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1.25ug/ml.](http://images.novusbio.com/fullsize/SLC35B1-Antibody-Western-Blot-NBP1-69299-img0001.jpg "Western Blot: SLC35B1 Antibody [NBP1-69299] - This Anti-SLC35B1 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1.25ug/ml.")
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to SLC35B1(solute carrier family 35, member B1) The peptide sequence was selected from the C terminal of SLC35B1.
Peptide sequence ALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPISPMQWVGT. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC35B1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 35 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 1 mg/ml |
| Purity | Protein A purified |
![Immunohistochemistry MYH7 Antibody (940906) [Unconjugated]](https://images.novusbio.com/images2/MYH7_MAB9096_Immunohistochemistry_19508.jpg)
![Western Blot MYH7 Antibody (940906) [Unconjugated]](https://images.novusbio.com/images2/MYH7_MAB9096_Western_Blot_19525.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
