SLC17A4 Antibody

Images

 
Western Blot: SLC17A4 Antibody [NBP1-59883] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry-Paraffin: SLC17A4 Antibody [NBP1-59883] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, EqSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC17A4 Antibody Summary

Immunogen
Synthetic peptides corresponding to SLC17A4(solute carrier family 17 (sodium phosphate), member 4) The peptide sequence was selected from the middle region of SLC17A4. Peptide sequence YFCEYWLFYTIMAYTPTYISSVLQANLRDSGILSALPFVVGCICIILGGL. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Equine (93%), Bovine (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC17A4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against SLC17A4 and was validated on Western Blot and immunohistochemistry-paraffin

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC17A4 Antibody

  • KAIA2138
  • KIAA2138
  • MGC129623
  • Na/PO4 cotransporter
  • putative small intestine sodium-dependent phosphate transport protein
  • solute carrier family 17 (sodium phosphate), member 4
  • Solute carrier family 17 member 4

Background

As a Na/PO4 cotransporter, SLC17A4 may be important to the regulation of Li transport and its therapeutic effects.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-69536
Species: Hu
Applications: WB
NBP2-02984
Species: Hu, Rt, Ca, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-05054
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31030
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-30117
Species: Hu, Mu
Applications: WB, IP
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP

Publications for SLC17A4 Antibody (NBP1-59883) (0)

There are no publications for SLC17A4 Antibody (NBP1-59883).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC17A4 Antibody (NBP1-59883) (0)

There are no reviews for SLC17A4 Antibody (NBP1-59883). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC17A4 Antibody (NBP1-59883) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLC17A4 Products

Bioinformatics Tool for SLC17A4 Antibody (NBP1-59883)

Discover related pathways, diseases and genes to SLC17A4 Antibody (NBP1-59883). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC17A4 Antibody (NBP1-59883)

Discover more about diseases related to SLC17A4 Antibody (NBP1-59883).
 

Pathways for SLC17A4 Antibody (NBP1-59883)

View related products by pathway.

Blogs on SLC17A4

There are no specific blogs for SLC17A4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC17A4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC17A4
Uniprot