Recombinant Human Slain2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Slain2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-298 of Human SLAIN2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MQEESLRQEYAATTSRRSSGSSCNSTRRGTFSDQELDAQSLDDEDDNMHHAVYPAVNRFSPSPRNSPRPSPKQSPRNSPRSRSPARGIEYSRVSPQPMISRLQQPRLSLQGHPTDLQTSNVKNEEKLRRSLPNLSRTSNTQVDSVKSSRSDSNFQVPNGGIPRMQPQASAIPSPGKFRSPAAPSPLALRQPVKAFSNHGSGSPGSQEITQLTQTTSSPGPPMVQSTVSANPPSNINSATLTRPAGTTAMRSGLPRPSAPSAGGIPVPRSKLAQPVRRSLPAPKTYGSMKDDSWKDGCY

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SLAIN2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Dilutions
  • Western Blot Western Blot
Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Slain2 Protein

  • KIAA1458FLJ21611
  • SLAIN motif family, member 2
  • SLAIN motif-containing protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5638
Species: Hu, Mu
Applications: WB, ICC
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NB500-182
Species: Hu, Mu, Rt, Ma
Applications: WB, ICC/IF, IP
H00388112-B01P
Species: Hu
Applications: WB, ELISA
AF1997
Species: Hu
Applications: WB, ChIP, ICC
H00009167-B02P
Species: Hu
Applications: WB, ELISA
H00056899-P01
Species: Hu
NBP1-84928
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85568
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00714
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00057606-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for Slain2 Recombinant Protein (H00057606-P01) (0)

There are no publications for Slain2 Recombinant Protein (H00057606-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Slain2 Recombinant Protein (H00057606-P01) (0)

There are no reviews for Slain2 Recombinant Protein (H00057606-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Slain2 Recombinant Protein (H00057606-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Slain2 Products

Slain2 H00057606-P01

Bioinformatics Tool for Slain2 Recombinant Protein (H00057606-P01)

Discover related pathways, diseases and genes to Slain2 Recombinant Protein (H00057606-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Slain2 Recombinant Protein (H00057606-P01)

Discover more about diseases related to Slain2 Recombinant Protein (H00057606-P01).
 

Pathways for Slain2 Recombinant Protein (H00057606-P01)

View related products by pathway.

PTMs for Slain2 Recombinant Protein (H00057606-P01)

Learn more about PTMs related to Slain2 Recombinant Protein (H00057606-P01).

Blogs on Slain2

There are no specific blogs for Slain2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Slain2 Antibody
NBP1-45225
OCT4 Antibody
NB100-2379

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Slain2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLAIN2