SERINC2 Antibody

Images

 
Western Blot: SERINC2 Antibody [NBP1-60102] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SERINC2 Antibody Summary

Immunogen
Synthetic peptides corresponding to SERINC2(serine incorporator 2) The peptide sequence was selected from the N terminal of SERINC2. Peptide sequence VCEEGAGIPTVLQGHIDCGSLLGYRAVYRMCFATAAFFFFFTLLMLCVSS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SERINC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SERINC2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SERINC2 Antibody

  • FKSG84
  • PRO0899
  • serine incorporator 2
  • TDE2
  • TDE2L

Background

The specific function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81422
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13296
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-87416
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38369
Species: Hu
Applications: IHC, IHC-P
H00001646-M03
Species: Hu
Applications: WB, ELISA
NB300-581
Species: Hu, Mu, Rt, Po, Am, Ca, GP, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
NBP1-60102
Species: Hu
Applications: WB

Publications for SERINC2 Antibody (NBP1-60102) (0)

There are no publications for SERINC2 Antibody (NBP1-60102).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SERINC2 Antibody (NBP1-60102) (0)

There are no reviews for SERINC2 Antibody (NBP1-60102). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SERINC2 Antibody (NBP1-60102) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SERINC2 Products

Bioinformatics Tool for SERINC2 Antibody (NBP1-60102)

Discover related pathways, diseases and genes to SERINC2 Antibody (NBP1-60102). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SERINC2

There are no specific blogs for SERINC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SERINC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SERINC2