SEL1L3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SEL1L3 Antibody [NBP2-58051] - Staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: SEL1L3 Antibody [NBP2-58051] - Immunohistochemical staining of human duodenum shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SEL1L3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ERCAEVQEIVSVYASAAKHGGERQEACHLHNSYLDLQRRYGRPSMCRAFPWEKELKDKHPSLFQALLEMDLLTVPRNQNESVSEIGGKIFEKAVKRLSSIDGL
Specificity
Specificity of human SEL1L3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEL1L3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SEL1L3 Recombinant Protein Antigen (NBP2-58051PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SEL1L3 Antibody

  • DKFZp781J1697
  • FLJ21629
  • KIAA0746FLJ41299
  • protein sel-1 homolog 3
  • sel-1 suppressor of lin-12-like 3 (C. elegans)
  • Sel-1L3
  • Suppressor of lin-12-like protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-04676
Species: Hu, Mu, Rt, Po, Gt, Ha, Sq
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC, KO
NBP1-03561
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF2680
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-58051
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SEL1L3 Antibody (NBP2-58051) (0)

There are no publications for SEL1L3 Antibody (NBP2-58051).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SEL1L3 Antibody (NBP2-58051) (0)

There are no reviews for SEL1L3 Antibody (NBP2-58051). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SEL1L3 Antibody (NBP2-58051) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SEL1L3 Products

Bioinformatics Tool for SEL1L3 Antibody (NBP2-58051)

Discover related pathways, diseases and genes to SEL1L3 Antibody (NBP2-58051). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SEL1L3

There are no specific blogs for SEL1L3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SEL1L3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SEL1L3