Recombinant Human SCML2 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human SCML2 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 251-350 of Human SCML2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: AKTESSPSEASQHSMQSPQKTTLILPTQQVRRSSRIKPPGPTAVPKRSSSVKNITPRKKGPNSGKKEKPLPVICSTSAASLKSLTRDRGMLYKDVASGPC

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
SCML2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SCML2 GST (N-Term) Protein

  • sex comb on midleg (Drosophila)-like 2
  • sex comb on midleg-like 2 (Drosophila)
  • sex comb on midleg-like protein 2

Background

SCML2 - sex comb on midleg-like 2 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004810-M05
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
H00006322-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-56487
Species: Hu
Applications: IHC, IHC-P
NBP1-84881
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00065108-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP2-20932
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45724
Species: Hu
Applications: WB, IHC
NBP2-85009
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32447
Species: Hu
Applications: WB, ICC/IF
NBP2-38127
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1240
Species: Hu
Applications: WB, PEP-ELISA
NBP2-32515
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67451
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-32356
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-80870
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ELISA, IHC, IHC-P
NBP2-24597
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, IHC, IHC-P

Publications for SCML2 Partial Recombinant Protein (H00010389-Q01) (0)

There are no publications for SCML2 Partial Recombinant Protein (H00010389-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCML2 Partial Recombinant Protein (H00010389-Q01) (0)

There are no reviews for SCML2 Partial Recombinant Protein (H00010389-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCML2 Partial Recombinant Protein (H00010389-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional SCML2 Products

Bioinformatics Tool for SCML2 Partial Recombinant Protein (H00010389-Q01)

Discover related pathways, diseases and genes to SCML2 Partial Recombinant Protein (H00010389-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCML2 Partial Recombinant Protein (H00010389-Q01)

Discover more about diseases related to SCML2 Partial Recombinant Protein (H00010389-Q01).
 

Pathways for SCML2 Partial Recombinant Protein (H00010389-Q01)

View related products by pathway.

PTMs for SCML2 Partial Recombinant Protein (H00010389-Q01)

Learn more about PTMs related to SCML2 Partial Recombinant Protein (H00010389-Q01).

Blogs on SCML2

There are no specific blogs for SCML2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SCML2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SCML2