RSPH4A Antibody

Images

 
Western Blot: RSPH4A Antibody [NBP1-90572] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: RSPH4A Antibody [NBP1-90572] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: RSPH4A Antibody [NBP1-90572] - Staining of human fallopian tube shows strong positivity in ciliated cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RSPH4A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DVSYNNAKQKELRFDVFQEEDSNSDYDLQQPAPGGSEVAPSMLEITIQNAKAYLLKTSSNSGFNLYDHLSNMLTKI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RSPH4A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RSPH4A Protein (NBP1-90572PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RSPH4A Antibody

  • MGC126303
  • radial spoke head 4 homolog A (Chlamydomonas)
  • radial spokehead-like 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86750
Species: Hu
Applications: IHC, IHC-P
NBP1-89840
Species: Hu
Applications: WB, IHC, IHC-P

Publications for RSPH4A Antibody (NBP1-90572) (0)

There are no publications for RSPH4A Antibody (NBP1-90572).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RSPH4A Antibody (NBP1-90572) (0)

There are no reviews for RSPH4A Antibody (NBP1-90572). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RSPH4A Antibody (NBP1-90572) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RSPH4A Products

Bioinformatics Tool for RSPH4A Antibody (NBP1-90572)

Discover related pathways, diseases and genes to RSPH4A Antibody (NBP1-90572). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RSPH4A Antibody (NBP1-90572)

Discover more about diseases related to RSPH4A Antibody (NBP1-90572).
 

Pathways for RSPH4A Antibody (NBP1-90572)

View related products by pathway.

Blogs on RSPH4A

There are no specific blogs for RSPH4A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RSPH4A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RSPH4A